NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233391_1009446

Scaffold Ga0233391_1009446


Overview

Basic Information
Taxon OID3300024304 Open in IMG/M
Scaffold IDGa0233391_1009446 Open in IMG/M
Source Dataset NameSubsurface microbial communities from Mancos shale, Colorado, United States - Mancos A_10_July_PB
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Colorado
CoordinatesLat. (o)38.96Long. (o)-106.99Alt. (m)Depth (m)10
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092148Metagenome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0233391_10094461F092148N/AMSNIKKREDLSGKIKIALDKAIVKVVAETKAKNSYLVVADKKGNIKKIPAKDL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.