Scaffold Ga0224556_1000287

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224556_1000287

Scaffold Ga0224556_1000287

Overview

Basic Information
Taxon OID	3300024295 Open in IMG/M
Scaffold ID	Ga0224556_1000287 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12710
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (58.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location Name	Sweden: Norrbotten County, Stordalen Mire
Coordinates	Lat. (^o)	68.3532	Long. (^o)	19.0475	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062809	Metagenome / Metatranscriptome	130	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224556_10002876	F062809	GGAGG	MKRPGTHQVALALICLVCVFVALQNTKGLDGTEFSGGWLTGPLLSMADIGMVLFLLAVGVAFVLPRVAAAMGLASSLLCLPLYLYLTAPVPFNRIFGFGHEFKVQPSGGFHWDRWAITGVLTLAVTTYICLRGVAAARHEQTPL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.