Scaffold Ga0247692_1052711

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0247692_1052711

Scaffold Ga0247692_1052711

Overview

Basic Information
Taxon OID	3300024279 Open in IMG/M
Scaffold ID	Ga0247692_1052711 Open in IMG/M
Source Dataset Name	Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK33
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	631
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location Name	USA: Indiana
Coordinates	Lat. (^o)	40.4449	Long. (^o)	-87.0297	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062208	Metagenome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247692_10527111	F062208	N/A	LATGVVTQVGWDGEKHTLWPWDLATKANFKPIFPSPSWQERESKPKPAS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.