Scaffold Ga0209976_10255101

Overview

Basic Information

• Taxon OID: 3300024265
• Scaffold ID: Ga0209976_10255101
• Source Dataset Name: Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 931
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location

• Location Name: near North Sumatra
• Coordinates
  • Lat. (^o): 1.759
  • Long. (^o): 96.774
  • Depth (m): 1855

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074578	Metagenome / Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209976_102551012	F074578	GGAG	MGRMVQTPLNSITIGADSTQDLWSLMAAATNKLILHGWEISSDSIAAALLEVTLLRLSSVGSAGAAVTEVKLDTDDGAITGSVRVGDTTPGTPGDVLAGYQWEQLGPLGMIYTPEMRPVIEVSTGIALVCNTADAFEMSGWICWEEI