NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247676_1025178

Scaffold Ga0247676_1025178


Overview

Basic Information
Taxon OID3300024249 Open in IMG/M
Scaffold IDGa0247676_1025178 Open in IMG/M
Source Dataset NameSoil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)947
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)40.4449Long. (o)-87.0297Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004122Metagenome / Metatranscriptome452Y
F015781Metagenome / Metatranscriptome252Y

Sequences

Protein IDFamilyRBSSequence
Ga0247676_10251781F004122GAGMTEKGLSDTDRRSAELRYEWQSFLGLLPVLDLRLIDPVLYQRCLTAVWLSRKSAIGRTDLQQAEGLGFQAEAVDFDLLVARLVREGILEPIVSSPFHFQIRRRNWTNPESAYAADDRLSLSAISREEQTARFRMLGLLDARILNPRLPGKRVQQIRKERDELAGIYEATWLELENAIGRKAAEAIRKSVEETTEAGAFQLDLPLEKKRHFDLEGEARCNQ
Ga0247676_10251782F015781AGGMNSVVETTVADSASAEAQLPSRVLEIRPEESKLVCVGADGREFVLSRLVGSNVRVG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.