NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0247664_1007210

Scaffold Ga0247664_1007210


Overview

Basic Information
Taxon OID3300024232 Open in IMG/M
Scaffold IDGa0247664_1007210 Open in IMG/M
Source Dataset NameSoil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2539
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil Microbial Communities From Purdue University Martell Research Forest, Indiana, United States

Source Dataset Sampling Location
Location NameUSA: Indiana
CoordinatesLat. (o)40.4449Long. (o)-87.0297Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008158Metagenome / Metatranscriptome338Y
F105754Metagenome / Metatranscriptome100N

Sequences

Protein IDFamilyRBSSequence
Ga0247664_10072101F008158GGCGGMLQQPVSPEPGRDGDPRQAEEDWLLWCESVENQLDPDEEEPDDAAPWDADLDAIIAECREITAEEAALAARAVRRGLPGGTPVADGRRGPGQPGSAQRRPGEFRSRAAGFAAG
Ga0247664_10072102F105754AGCAGMHLFLYAGSAKAADEAGQVARAVLEEHGQFAEVRVERWDPSGGEWRDRDEPAEHEDPPEPGRLQTTAVAFIKGAGQALARGDLA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.