NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233399_1005647

Scaffold Ga0233399_1005647


Overview

Basic Information
Taxon OID3300024231 Open in IMG/M
Scaffold IDGa0233399_1005647 Open in IMG/M
Source Dataset NameSeawater microbial communities from Monterey Bay, California, United States - 43D
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4319
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033439Metagenome / Metatranscriptome177Y
F050274Metagenome / Metatranscriptome145Y
F061764Metagenome / Metatranscriptome131Y

Sequences

Protein IDFamilyRBSSequence
Ga0233399_10056471F033439GGAGMIPALPYSKLVEKHILDCIQGGIGIRQMIASMQHLQDAPKSLSTMYKIYGSFIEMERAKINGAVGK
Ga0233399_10056472F061764GGAGMLTGGKRFCFHTVASKSEALDKLAVLERRHDSRYQFEIEPYVF
Ga0233399_10056476F050274GGAGGMKHEKQARALIRKMIRSARQDWTTCVYVTPYGDDETINERQHEGEILDAVFCCDETVIRFHDMTTGRNLGSVLIVLEYDREPDEIISDHTDNDYINRLLTHIGA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.