Scaffold Ga0224565_1013816

Overview

Basic Information

• Taxon OID: 3300024176
• Scaffold ID: Ga0224565_1013816
• Source Dataset Name: Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 864
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.043
  • Long. (^o): 13.6183

Associated Families

Family	Category	Number of Sequences	3D Structure?
F100738	Metagenome / Metatranscriptome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224565_10138162	F100738	AGGAGG	LSKSIRVENEAEELIALQAIETYRALQQAVKTAPHGKGLVTVEAVVHDKGFDHLRQMYQSALQEHPEAKKKGPAL