NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0233345_1002194

Scaffold Ga0233345_1002194


Overview

Basic Information
Taxon OID3300024045 Open in IMG/M
Scaffold IDGa0233345_1002194 Open in IMG/M
Source Dataset NameLeaf litter microbial communities from Shasta-Trinity National Forest, California, United States - GEON-DECOMP-285
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1742
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Leaf Litter → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)40.2198Long. (o)-122.9842Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F015054Metagenome257Y

Sequences

Protein IDFamilyRBSSequence
Ga0233345_10021941F015054N/AATNIISWKSRVLILEENDLLKLVNEKVLEPDVEEDKSHWRKSDAKARRILVDSVRDHFVSHMSQKKTTRKMFKTLTE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.