NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0228681_1044593

Scaffold Ga0228681_1044593


Overview

Basic Information
Taxon OID3300023683 Open in IMG/M
Scaffold IDGa0228681_1044593 Open in IMG/M
Source Dataset NameMetatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 22R (Metagenome Metatranscriptome)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)524
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → unclassified Betaproteobacteria → Betaproteobacteria bacterium TMED156(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater → Seawater Microbial Communities From Monterey Bay, California, United States

Source Dataset Sampling Location
Location NameUSA: California
CoordinatesLat. (o)36.8313Long. (o)-121.9047Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076520Metagenome / Metatranscriptome118N

Sequences

Protein IDFamilyRBSSequence
Ga0228681_10445931F076520AGGAGMNKLFSQYLNESKKSWKFCIKTVHDLTDEQCDRIEKHLGKYDSKGLGAAKKTILQSAPRDFPNHKGYEVFTHEFETNIIASGWQVQNDIRNMLGLADGVLKVKGEHEPDELIPPMGERVESVLADGEYNDAEKVNASDYYGDEYNSSFIKELMKVKKQKE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.