Scaffold Ga0247527_111851

Overview

Basic Information

• Taxon OID: 3300023664
• Scaffold ID: Ga0247527_111851
• Source Dataset Name: Metatranscriptome of spruce roots microbial communities from Bohemian Forest, Czech Republic - CRA1 (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 602
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Amabiliviricetes → Wolframvirales → Narnaviridae → unclassified Narnaviridae → Botrytis cinerea binarnavirus 5 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location

• Location Name: Czech Republic: South Bohemian Region
• Coordinates
  • Lat. (^o): 49.043
  • Long. (^o): 13.6183

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019067	Metagenome / Metatranscriptome	231	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0247527_1118511	F019067	N/A	LDLNEIYQLGRRTASIAIEQGVPLLGRGTKVLGREVGDDRVDLSRTPDSLCTTLVVQEDVIKMVTSPEDTSVRMKSWNFCEVTSGPLTDPSQGFDHVRKNGDFSDLGFNDSVVLRIILDVQKGEGEEHSSTPPGKMSMLGSRLATPRRENRGMWMIASVFQDSMLCTHKATEPKYLPSVMGGTGVTALFDNSNNVFLYTL