Scaffold Ga0257045_107971

Overview

Basic Information

• Taxon OID: 3300023491
• Scaffold ID: Ga0257045_107971
• Source Dataset Name: Human gut microbial communities from healthy child feces in Northridge, California, USA - CDI_28A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of California, Irvine
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3289
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (20.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Gut → Child Gut Microbiome

Source Dataset Sampling Location

• Location Name: USA: Northridge, California
• Coordinates
  • Lat. (^o): 34.2381
  • Long. (^o): -118.5301

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055775	Metagenome	138	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0257045_1079713	F055775	N/A	MAQIAQQDNLVIEVTTTAAALDGDTKKKLIECIKGGTITDVILVTKEVEKKISHARVVSWLVDTTGNSPKYTIDIINANSGAVEKIALN