Scaffold Ga0257020_142656

Overview

Basic Information

• Taxon OID: 3300023445
• Scaffold ID: Ga0257020_142656
• Source Dataset Name: Marine microbial mat from Loihi Seamount, Hawaii, USA - Marker 34 Individual Assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Western Washington University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 853
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → unclassified Flavobacteriales → Flavobacteriales bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Marine → Marine Microbial Mats From Loihi Seamount, Hawaii, Usa

Source Dataset Sampling Location

• Location Name: Loihi Seamount, Hawaii, USA
• Coordinates
  • Lat. (^o): 18.903
  • Long. (^o): -155.257

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054945	Metagenome / Metatranscriptome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0257020_1426562	F054945	GAGG	MKWVILIYLAMWTNTPEVIKYTRLEFPASNFQECIDIAQQINDITNAHKSDVPYVRSFYWVYNNMLDEIKAECVYADPAAPVPEWYKYYWSHPEWFKEYTRKQWKEDKKRDWRIPPDHPMIPPE