Scaffold Ga0222710_1053724

Overview

Basic Information

• Taxon OID: 3300023429
• Scaffold ID: Ga0222710_1053724
• Source Dataset Name: Saline water microbial communities from Ace Lake, Antarctica - #1696
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 682
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Phycisphaerae → unclassified Phycisphaerae → Phycisphaerae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Ace Lake
• Coordinates
  • Lat. (^o): -68.4725
  • Long. (^o): 78.188
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002804	Metagenome / Metatranscriptome	529	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222710_10537243	F002804	GAG	MELILDAYVLATSLITIASVICNYTDTPKDDVWVAKAYKMMEQFAFL