NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0256681_12614052

Scaffold Ga0256681_12614052


Overview

Basic Information
Taxon OID3300023311 Open in IMG/M
Scaffold IDGa0256681_12614052 Open in IMG/M
Source Dataset NameCombined Assembly of Gp0281739, Gp0281740, Gp0281741
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLaval University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)574
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location NameSAS2a, Kuujjuarapick, Canada
CoordinatesLat. (o)55.1491Long. (o)-77.4866Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032872Metagenome / Metatranscriptome179Y

Sequences

Protein IDFamilyRBSSequence
Ga0256681_126140521F032872N/ARFTRAASSTSGRAKKQILISSVPGQEPESRGMPAPNDLREAYTGQKRGPQAGFASCLSNSASKCLAADGDGLGMPEPNTDGAAAGEALEGLPGSKSVARAAEAAGNQGDPGGSRRTNYEGQAGRGVQRQEERPEARQGVGFVHSSPRQDASLEAGEGTNRLTKHAQATRCRTNDGSTLANLPAGDTQRVSL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.