Scaffold Ga0209414_1068866

Overview

Basic Information

• Taxon OID: 3300023301
• Scaffold ID: Ga0209414_1068866
• Source Dataset Name: Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 917
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Bacillaceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Hypersaline Microbial Communities From Lake Vida, Antarctica

Source Dataset Sampling Location

• Location Name: Lake Vida, Antarctica
• Coordinates
  • Lat. (^o): -77.38861
  • Long. (^o): 161.931111

Associated Families

Family	Category	Number of Sequences	3D Structure?
F099976	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209414_10688663	F099976	GGAGG	MSKSQATRRNEAGEVKRQEIIELFKSMRKTQLNDGREISSLSLNELQELYKYGIKK