Scaffold Ga0222702_1064796

Overview

Basic Information

• Taxon OID: 3300023299
• Scaffold ID: Ga0222702_1064796
• Source Dataset Name: Saline water microbial communities from Ace Lake, Antarctica - #1504
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 747
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → unclassified Campylobacterota → Epsilonproteobacteria bacterium JGI 0002006-B18 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Ace Lake
• Coordinates
  • Lat. (^o): -68.4725
  • Long. (^o): 78.188
  • Depth (m): 24

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010230	Metagenome	306	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222702_10647961	F010230	AGG	MPLLVSINGNELRLLQLFQAKLKLVPLLVSINGNELRLLQPRQVWSKLVPLLVSINGNELRLLQPSQVWLKVVPLLVSINGKELRLLQYRQVKLKLVPLLVSINGKELRLLQLFQVALNLVPLLVSINGNELRLLHSPQVESKLVPLLVSINGNELRLLQNCQVAVKLMPLLVSINGNELRLLQYRQVK