Scaffold Ga0222670_1002381

Overview

Basic Information

• Taxon OID: 3300023294
• Scaffold ID: Ga0222670_1002381
• Source Dataset Name: Saline water microbial communities from Ace Lake, Antarctica - #732
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 5758
• Total Scaffold Genes: 15
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 11 (73.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → unclassified Candidatus Pelagibacter → Candidatus Pelagibacter sp. TMED203 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Ace Lake
• Coordinates
  • Lat. (^o): -68.4725
  • Long. (^o): 78.188
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054920	Metagenome	139	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0222670_100238115	F054920	N/A	DTRVRNHYTKIVDTGVEFYTCDDDDLDKEYGMYYGNLDFDPLEIMAFRNGHTKMFYKENGKWQPL