Scaffold Ga0256703_11065113

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0256703_11065113

Scaffold Ga0256703_11065113

Overview

Basic Information
Taxon OID	3300023291 Open in IMG/M
Scaffold ID	Ga0256703_11065113 Open in IMG/M
Source Dataset Name	Food waste and fibre mixture microbial community, University of Toronto, Ontario, Canada. Combined Assembly of Gp0242115, Gp0242119
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Toronto
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1005
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Aerobic → Unclassified → Unclassified → Food Waste → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location
Location Name	University of Toronto, Toronto, Ontario, Canada
Coordinates	Lat. (^o)	43.6629	Long. (^o)	-79.3957	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011632	Metagenome	288	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0256703_110651131	F011632	N/A	AAQRGGGVTEPGGVQRAFGCCVEGHGLARTIGEGRMVGLDDPVGLFRP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.