Scaffold Ga0224535_1088596

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224535_1088596

Scaffold Ga0224535_1088596

Overview

Basic Information
Taxon OID	3300023258 Open in IMG/M
Scaffold ID	Ga0224535_1088596 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	676
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location Name	Sweden: Norrbotten County, Stordalen Mire
Coordinates	Lat. (^o)	68.3532	Long. (^o)	19.0469	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000758	Metagenome / Metatranscriptome	903	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224535_10885961	F000758	N/A	MKEETNMAPTKKAAARPKRRIVAPAETRTQIRLTVDSKFTKSHFSQLFAVLKIRRKNALAEHIIMNFKTKA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.