Scaffold Ga0224535_1041141

Overview

Basic Information

• Taxon OID: 3300023258
• Scaffold ID: Ga0224535_1041141
• Source Dataset Name: Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1075
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium ADurb.Bin118 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3532
  • Long. (^o): 19.0469
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036902	Metagenome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224535_10411411	F036902	N/A	MADTKDLLDFLEGGIGMFFDMRLELLGVELAPMPPALFRGQRALFGGDEIPINGTPSQIKPPGGLGFGAAALNEFHHPFPQVQRIGFHALKPITLCPNVNMKCYTYSRKVLL