Scaffold Ga0222676_1061131

Overview

Basic Information

• Taxon OID: 3300023240
• Scaffold ID: Ga0222676_1061131
• Source Dataset Name: Saline water microbial communities from Ace Lake, Antarctica - #870
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 520
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Ace Lake
• Coordinates
  • Lat. (^o): -68.4725
  • Long. (^o): 78.188
  • Depth (m): 12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071010	Metagenome	122	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0222676_10611311	F071010	N/A	DGDNQQWVYTFVTYDAVATVEHEATDIMTLGYAYGNEGRNVTTVSNKTLLIPQQYKINRQGSFVFPIYVPTGVAAQAITVKSYPALTINYSATPAQSDLSDEVVKYLWIDATVATNESYIEIIWNGKTTTLDITRECKYTPLDTFFQNKDGALQSFTLFKKQEESINVTDSS