Scaffold Ga0222661_1003495

Overview

Basic Information

• Taxon OID: 3300023229
• Scaffold ID: Ga0222661_1003495
• Source Dataset Name: Saline water microbial communities from Ace Lake, Antarctica - #551
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3615
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location

• Location Name: Antarctica: Ace Lake
• Coordinates
  • Lat. (^o): -68.4725
  • Long. (^o): 78.188
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033223	Metagenome	178	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0222661_10034952	F033223	N/A	MAFDCFYKVTVTTCVPDSINMFVDEEVYHWGYFPYSWVMKDVRQLYKDGADAVVLEMITQEQFDRRMEKYKNQQAWEEYQTNGIWNGEEE