Scaffold Ga0255811_11046597

Overview

Basic Information

• Taxon OID: 3300023207
• Scaffold ID: Ga0255811_11046597
• Source Dataset Name: Combined Assembly of Gp0238866, Gp0238878, Gp0238879
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Toronto
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4741
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (62.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Digester Digestate → Metagenomes From Anaerobic Digester Of Solid Waste

Source Dataset Sampling Location

• Location Name: University of Toronto, Toronto, Ontario, Canada
• Coordinates
  • Lat. (^o): 43.5479
  • Long. (^o): -79.6609

Associated Families

Family	Category	Number of Sequences	3D Structure?
F047561	Metagenome	149	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255811_110465972	F047561	N/A	MVKSNIQPQNIVPDFGTLKRGKLDILVNWDITSNTKTDDMGNEYTEWQYESVRLNWVLPAVYESEAAIRAYLDANYNEGENILGWAQATRVNKSLYRK