Scaffold Ga0214919_10244040

Overview

Basic Information

• Taxon OID: 3300023184
• Scaffold ID: Ga0214919_10244040
• Source Dataset Name: Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1294
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Nematoda → Chromadorea → Rhabditida → Spirurina → Spiruromorpha → Filarioidea → Onchocercidae → Wuchereria → Wuchereria bancrofti (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 34.2611
  • Long. (^o): -83.95
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013761	Metagenome / Metatranscriptome	268	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214919_102440401	F013761	N/A	MKIELCISRDRVPYIVGEFGADRVVVSKYNEDQDLVVFEVDSQMDFLYMFHAGIRCGSDSMGKALSKQVV