NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214919_10035150

Scaffold Ga0214919_10035150


Overview

Basic Information
Taxon OID3300023184 Open in IMG/M
Scaffold IDGa0214919_10035150 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5109
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (14.29%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008359Metagenome / Metatranscriptome334Y
F008491Metagenome / Metatranscriptome332Y
F073457Metagenome / Metatranscriptome120Y

Sequences

Protein IDFamilyRBSSequence
Ga0214919_1003515011F008491GGAMAKKIATKVNYQVTELVNNLNEAATTTSEQKRDFFTTKALYNAKRLSTILNKAKVGAMAVIITLGMVACGSGNTTNVAIADSTATDSAKVDTAVTPVVDSTSVK
Ga0214919_100351502F073457N/AMSKFTIEFKEGIKSGSNRLVSIMENPYKNFAASKMSLGKKTMCIVEFTDLLGKKHTIQCSNRKQMLDAQKFLGMFKSESLKVKNILMEYPISFGRIPKKYMSELRSELKEFGFTYSFINKLAGY
Ga0214919_100351504F008359N/AMSKSKVNIKKNYEIKKVRKVMRMKDNNFEPATYEIFKVSGPNKFKKYFCSRKDAKSYIDKITDTKMTLTIVKNIMNEIKYK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.