Scaffold Ga0255772_10001279

Overview

Basic Information

• Taxon OID: 3300023176
• Scaffold ID: Ga0255772_10001279
• Source Dataset Name: Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 25126
• Total Scaffold Genes: 36
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 21 (58.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Coastal Salt Marsh Microbial Communities From The Groves Creek Marsh, Skidaway Island, Georgia

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 31.972
  • Long. (^o): -81.028
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F072239	Metagenome	121	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0255772_100012796	F072239	N/A	MKISELVVGEFYIIKPTTKKEVIVDGSSLQLASVSRRQEKNKIYKESLYVYLGQTIEKVEKRVDSKTRNVYTYKPHIMQCVKTGELFKINGYYIQTYFVKPKK