Scaffold Ga0214921_10283717

Overview

Basic Information

• Taxon OID: 3300023174
• Scaffold ID: Ga0214921_10283717
• Source Dataset Name: Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 938
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 34.2611
  • Long. (^o): -83.95
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030734	Metagenome / Metatranscriptome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214921_102837175	F030734	N/A	MGRAAKMADDQYQGEVQPGAQKQDMGKGGPKQTPRKPGKGPTSSVSPRGVGMARNKPCKM