Scaffold Ga0214921_10001900

Overview

Basic Information

• Taxon OID: 3300023174
• Scaffold ID: Ga0214921_10001900
• Source Dataset Name: Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 34986
• Total Scaffold Genes: 35
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 20 (57.14%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 34.2611
  • Long. (^o): -83.95
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F044151	Metagenome / Metatranscriptome	155	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0214921_100019001	F044151	N/A	VTQVYNPRVCSVLGALYFLEPMLIELGLGTSFDERDRLASDEPNVNLTSP