Scaffold Ga0233357_1004353

Overview

Basic Information

• Taxon OID: 3300023056
• Scaffold ID: Ga0233357_1004353
• Source Dataset Name: Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1339
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 40.3809
  • Long. (^o): -123.4135
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023700	Metagenome / Metatranscriptome	209	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233357_10043532	F023700	N/A	ERTLLASTQSSVKDIEQRLKDLRHEVERRVKAPGTDLKAAPFQSSAKVVSLPAYTEVVIVIVTPHWLGVETPGGQRGWIAIEQLEPLP