Scaffold Ga0233356_1036910

Overview

Basic Information

• Taxon OID: 3300023046
• Scaffold ID: Ga0233356_1036910
• Source Dataset Name: Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 598
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Soil And Plant Litter Microbial Communities From Temperate Forests In California, United States

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 40.282
  • Long. (^o): -123.2869
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011513	Metagenome / Metatranscriptome	290	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233356_10369101	F011513	N/A	ISRSDAAHNASVSSIDAACVHDLRIMVAHGFRNLQKRQL