Scaffold Ga0224560_113713

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224560_113713

Scaffold Ga0224560_113713

Overview

Basic Information
Taxon OID	3300023019 Open in IMG/M
Scaffold ID	Ga0224560_113713 Open in IMG/M
Source Dataset Name	Soil microbial communities from Bohemian Forest, Czech Republic ? CSU1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	509
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil, Plant Litter And Rhizosphere Microbial Communities From European Coniferous Forests

Source Dataset Sampling Location
Location Name	Czech Republic: South Bohemian Region
Coordinates	Lat. (^o)	49.043	Long. (^o)	13.6183	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041070	Metagenome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224560_1137132	F041070	N/A	AMLETALDAQSPPDKFAIDIMLAAMAGAMRSLLEAGPTSAMVRKSREQLVLLCQSYMAAATAKQG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.