Scaffold Ga0233429_1235253

Overview

Basic Information

• Taxon OID: 3300022902
• Scaffold ID: Ga0233429_1235253
• Source Dataset Name: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_135_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Restricted
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Note: The use of this dataset is restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of the sequences below requires obtaining a license from the dataset's corresponding author(s).

Scaffold Components

• Scaffold Length (bps): 631
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater → Methane Metabolizing Microbial Communities From Different Methane-Rich Environments From Various Locations

Source Dataset Sampling Location

• Location Name: Canada: British Columbia
• Coordinates
  • Lat. (^o): 48.5847
  • Long. (^o): -123.5008
  • Depth (m): 135

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038639	Metagenome	165	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0233429_12352531	F038639	N/A	NTLHEETMKHAKQKTLSQSTIDLLSYMSKLVDQGFTPEETVEYMTDCEPEWRCSKGYPASRGGLRQAKQRLDRRIEMMKQVNNGVTVFINNKPKQ