Scaffold Ga0224545_1001223

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0224545_1001223

Scaffold Ga0224545_1001223

Overview

Basic Information
Taxon OID	3300022881 Open in IMG/M
Scaffold ID	Ga0224545_1001223 Open in IMG/M
Source Dataset Name	Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5328
Total Scaffold Genes	12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location Name	Sweden: Norrbotten County, Stordalen Mire
Coordinates	Lat. (^o)	68.3533	Long. (^o)	19.0471	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F060308	Metagenome	133	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224545_10012238	F060308	N/A	MAVKRQPAGFKRRKLSAVVRKAITSYYTDQEQLEIEQAAKQQKISKSSFVASAALKEARR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.