NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0224545_1000112

Scaffold Ga0224545_1000112


Overview

Basic Information
Taxon OID3300022881 Open in IMG/M
Scaffold IDGa0224545_1000112 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Stordalen Mire, Sweden - 717 P1 20-24
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16258
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (77.27%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location
Location NameSweden: Norrbotten County, Stordalen Mire
CoordinatesLat. (o)68.3533Long. (o)19.0471Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002101Metagenome / Metatranscriptome593Y
F003337Metagenome / Metatranscriptome493Y
F060292Metagenome / Metatranscriptome133Y

Sequences

Protein IDFamilyRBSSequence
Ga0224545_100011212F002101AGGAGVTNIALLLPPPEGSLEKKKRVLLLDTSQTKRDLRAEVMRRLGIDVDCAADVLEARCWWRADLYNLVLINAIGEAEGRDKFCTDIRNAIPPQKIAFFVGGPEYLSSAPNSDAARVEADPDTVHKQMVAALLAKSLQNSSQRWGILEACKRISSVRSVSEARSRAIRETPRPSRWAEAIEQHSVSEEIHSQPIFANAIAASEREGIL
Ga0224545_100011214F003337AGGVSSSRDLISWVMVLLFPLSLLAADTGSAVVHSSGGVWVNGAEVSDSTTVFSGDLLETKAGFVADLASEGSSVLIQGESIVKFQGDYLVLEHGSVAVGTSTSMSVHVNCINVEPLSNDRTQYDVTNLSTKVEVRAHKDDVNIRRGGTLRKTSAESNSSESGTVHEGQQAMRDESITCGAAAVPHGAGTAVNTKWLEIGGGAGGGALVLCLLLCKGSKQSSVSPSQP
Ga0224545_100011216F060292GGAMESGRLLTVLSPQDFLRSNDPLAAAYVQAFGEGLDSVANRGAS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.