Scaffold Ga0224549_1008511

Overview

Basic Information

• Taxon OID: 3300022840
• Scaffold ID: Ga0224549_1008511
• Source Dataset Name: Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 1-5
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1529
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Acidobacteria (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil → Peatland Microbial Communities From Stordalen Mire, Sweden

Source Dataset Sampling Location

• Location Name: Sweden: Norrbotten County, Stordalen Mire
• Coordinates
  • Lat. (^o): 68.3535
  • Long. (^o): 19.0472
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062016	Metagenome / Metatranscriptome	131	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0224549_10085112	F062016	N/A	TFNKLATCALMMLVLAASAFAQAPGPETTLANLTEGQGTIASSGNPQWDGYSELVLIPGASLMGATSTSTALYIGFTGGTEADIGNMVLYSTLRGNDAVIKATKVTLSGSSDPSIDLTSASVCPNGAPTATTPCIIRLDTVKAALSTLDDYYFVVYFTLDTNNEKIVGVGQSVEPGALSGFYLYGDQTRIGAKGAIATNENTDQPAFFLAYVANE