Scaffold Ga0222649_1030873

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0222649_1030873

Scaffold Ga0222649_1030873

Overview

Basic Information
Taxon OID	3300022839 Open in IMG/M
Scaffold ID	Ga0222649_1030873 Open in IMG/M
Source Dataset Name	Saline water microbial communities from Ace Lake, Antarctica - #337
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	643
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Lake Microbial Communities From Various Lakes In Antarctica

Source Dataset Sampling Location
Location Name	Antarctica: Ace Lake
Coordinates	Lat. (^o)	-68.4725	Long. (^o)	78.188	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018925	Metagenome / Metatranscriptome	232	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0222649_10308732	F018925	GAGG	MAANVYTSLANAVVYTDKLSISTTGGTAITYNVYAVALGSADPVGNLYSAAVQIPANSQSQVYVGAGNKVTITGANWTATELGTASSATASVYTP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.