Scaffold Ga0216341_10150424

Overview

Basic Information

• Taxon OID: 3300022753
• Scaffold ID: Ga0216341_10150424
• Source Dataset Name: Goat fecal pellet fungal communities from Santa Barbara, California, USA ? pellet 3 (v2)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2239
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.4204
  • Long. (^o): -119.6671
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083484	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0216341_101504241	F083484	AGGAGG	LKRIFSVLLSLLLLLSLFTVTAFAEEENDISKIELPAPKAPNYFVYTDGNASEGHHDDLRMIMVADPEVALLAAEYDRDSEAFYK