NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214917_10004916

Scaffold Ga0214917_10004916


Overview

Basic Information
Taxon OID3300022752 Open in IMG/M
Scaffold IDGa0214917_10004916 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)14527
Total Scaffold Genes36 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)28 (77.78%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Lake Lanier, Atlanta, Georgia, United States

Source Dataset Sampling Location
Location NameUSA: Georgia
CoordinatesLat. (o)34.2611Long. (o)-83.95Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008493Metagenome / Metatranscriptome332Y
F019477Metagenome / Metatranscriptome229Y
F029052Metagenome / Metatranscriptome189Y

Sequences

Protein IDFamilyRBSSequence
Ga0214917_1000491625F008493N/AMEKTKRTARKDSNFIIYEAVSASGENYIGLTRKTQSTVLKSLKERWRKHLSRARNEDRAWRLYEYMRAEGLEVTWEHRVLAIVRGRAEAYALERTVVKEQRPTLNDQYC
Ga0214917_100049166F019477AGGAGMYSRLFNELAVGRLFRYNGNDYVKQSSRTARRLANGRVIYFGQNETIHPIAY
Ga0214917_100049169F029052AGGAMEYLKQAELYAEARGDEFYFKNLYTQFREFNDIIDSVWKTLSYLYSNEVADMLTCWSHSEDY

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.