Scaffold Ga0228703_1012551

Overview

Basic Information

• Taxon OID: 3300022747
• Scaffold ID: Ga0228703_1012551
• Source Dataset Name: Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17_Aug_MG
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3041
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (75.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater → Freshwater Microbial Communities From Mcnutts Creek, Athens, Georgia, United States

Source Dataset Sampling Location

• Location Name: USA: Georgia
• Coordinates
  • Lat. (^o): 33.9263
  • Long. (^o): -83.4268
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089840	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0228703_10125511	F089840	AGGA	MAIKVNYIVAKNSPNLYAAAQAANLPPDQVGQLEQFSWTVDKNKSLSKLPIDQARSEYNALAPEIQDKLKYLFPKADYMQAAPDTSDYAVGALKTVGKVVASPLIGVFKLAGAWNRLINTPYLLARQAAQGENPFTKQSFTDAWDGRRVFDEGELTKTINYFGNERVDVAKGLLAGKTPGEIIKAAGGEVNNKLLAA