Scaffold Ga0228711_1054966

Overview

Basic Information

• Taxon OID: 3300022739
• Scaffold ID: Ga0228711_1054966
• Source Dataset Name: Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 725
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fabales → Fabaceae → Papilionoideae → 50 kb inversion clade → NPAAA clade → Hologalegina → IRL clade → Trifolieae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Plants → Roots → Nodule → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana

Source Dataset Sampling Location

• Location Name: USA: California
• Coordinates
  • Lat. (^o): 34.0136
  • Long. (^o): -118.4673
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048125	Metagenome	148	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0228711_10549662	F048125	GAG	MSGEEASSSGAGFGSGGARIPYDYNSTISKHEKSANHNKPPMFNGDPEMLVEIEDV