NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0242665_10387724

Scaffold Ga0242665_10387724


Overview

Basic Information
Taxon OID3300022724 Open in IMG/M
Scaffold IDGa0242665_10387724 Open in IMG/M
Source Dataset NameMetatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)508
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036814Metagenome / Metatranscriptome169Y

Sequences

Protein IDFamilyRBSSequence
Ga0242665_103877242F036814N/AGNYMKINVTREDIRNGKAGKPTACMVALALKRELGISYASVGYRDAKILVDGQYVKLYFPKSVEKKIRFWDGFHFVFPFSFELLPKGFLSGSAITLRAPNIRPAPGLICSSPQTA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.