NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0236339_1156040

Scaffold Ga0236339_1156040


Overview

Basic Information
Taxon OID3300022650 Open in IMG/M
Scaffold IDGa0236339_1156040 Open in IMG/M
Source Dataset NameFreshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Winter W3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterLaval University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1258
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location NameSAS2a, Kuujjuarapick, Canada
CoordinatesLat. (o)55.1491Long. (o)-77.4866Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054137Metagenome140Y

Sequences

Protein IDFamilyRBSSequence
Ga0236339_11560402F054137AGGAGGMIYVVRQRYKEWVKPEDFPKVSRLIDEVSSAMEKIPGVRSVRAFNSFGGEIIILVEIDGLAAIDRALVDEEYNRIASGMFDYMVRVGGDVWFDRTSWEECYGRKTKTSSRRSRGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.