Scaffold Ga0248169_132935

Overview

Basic Information

• Taxon OID: 3300022602
• Scaffold ID: Ga0248169_132935
• Source Dataset Name: Freshwater microbial communities from Trout Bog Lake, Vilas County, Wisconsin, United States - 30JULY2014 epilimnion
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: U.S. Department of Energy (DOE)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2692
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 5 (83.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Microbial Communities From Trout Bog Lake, Vilas County, Wisconsin, United States

Source Dataset Sampling Location

• Location Name: Trout Bog, Vilas County, Wisconsin, USA
• Coordinates
  • Lat. (^o): 46.0412
  • Long. (^o): -89.6861

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014940	Metagenome / Metatranscriptome	258	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0248169_1329354	F014940	AGGA	MSNYGGLSTVYHLNRLAGTIVNGVPQYDFNGAAVIWCYNVTGKKPSRGIDALNQIYAYRNGGVNYYQDTPGCLNLLAGTYGIGEAEAAARIAS