Scaffold Ga0215184_1059539

Overview

Basic Information

• Taxon OID: 3300022595
• Scaffold ID: Ga0215184_1059539
• Source Dataset Name: Metatranscriptome of coral microbial communities from Popa Island, Bocas del Toro, Panama - APAL T2 (Eukaryote Community Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4701
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 4 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia → Astrocoeniina → Acroporidae → Acropora (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location

• Location Name: Panama: Bocas del Toro
• Coordinates
  • Lat. (^o): 9.1956
  • Long. (^o): -82.1254
  • Depth (m): 15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030666	Metagenome / Metatranscriptome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0215184_10595391	F030666	GAG	MLPMASSFKIFINVFTFLYVKANSKENGEEILFPSFFKKMLMSAFLLRFKANYLEKIRGHPHFSFWIPIAFAKIYFFRMVPVWRKNLLI