Scaffold Ga0236340_1030224

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0236340_1030224

Scaffold Ga0236340_1030224

Overview

Basic Information
Taxon OID	3300022594 Open in IMG/M
Scaffold ID	Ga0236340_1030224 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Laval University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1339
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location Name	SAS2a, Kuujjuarapick, Canada
Coordinates	Lat. (^o)	55.1491	Long. (^o)	-77.4866	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089760	Metagenome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0236340_10302241	F089760	N/A	MNKKIPVIFLIALSSHLGAQTLTPEQVLAKMDICRQQVINQLSFGDKMKMKAAMGVIQNNPQIISANNEVINAPTPEAKVQARRTLAALKLNLLEKQDPSLKPIIAKIRAAQASVLH

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.