Scaffold Ga0236342_1001695

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0236342_1001695

Scaffold Ga0236342_1001695

Overview

Basic Information
Taxon OID	3300022592 Open in IMG/M
Scaffold ID	Ga0236342_1001695 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S3
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Laval University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	11124
Total Scaffold Genes	25 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	22 (88.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location
Location Name	SAS2a, Kuujjuarapick, Canada
Coordinates	Lat. (^o)	55.1491	Long. (^o)	-77.4866	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F079520	Metagenome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0236342_100169522	F079520	AGGA	MKLTSEEIHNIYLHQSGVAEGLSKAGSDADFPVLFANALLEFYELRKAQEK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.