Scaffold Ga0236341_1012594

Overview

Basic Information

• Taxon OID: 3300022591
• Scaffold ID: Ga0236341_1012594
• Source Dataset Name: Freshwater microbial communities from thermokarst lake SAS2a, Kuujjuarapick, Canada - Sample Summer S2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: Laval University
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2883
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (87.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Thermokarst Lakes Summer Vs Winter

Source Dataset Sampling Location

• Location Name: SAS2a, Kuujjuarapick, Canada
• Coordinates
  • Lat. (^o): 55.1491
  • Long. (^o): -77.4866

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027415	Metagenome / Metatranscriptome	194	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0236341_10125947	F027415	AGGA	MNDNVFIVCITTAVISLIGAVTFYNYEQLKSVQSNVESAIVKGIDPVAVRCAYAMSSDVVCVAYGATHQKTPTTK