NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0212123_10270210

Scaffold Ga0212123_10270210


Overview

Basic Information
Taxon OID3300022557 Open in IMG/M
Scaffold IDGa0212123_10270210 Open in IMG/M
Source Dataset NamePaint Pots_combined assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1207
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (25.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameCanada: Banff, British Columbia
CoordinatesLat. (o)51.1699Long. (o)-116.1578Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F044949Metagenome153Y
F047202Metagenome / Metatranscriptome150Y

Sequences

Protein IDFamilyRBSSequence
Ga0212123_102702102F044949AGGCGGMTNASGAGIVLEYRFRDSFCFHIRLAELLGTEMPRLIERLKIFHGEIISVSEPRFAGKVR
Ga0212123_102702103F047202N/AMKAFKHRSDQGIDTARALDLVQTEFSSIVAAGGRKYVGVLKEIPNKMESVVLFNSPRTRTTLGIRVSRLTVEAVRKHLAESDAAFAEAGAK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.