Scaffold Ga0212088_10656909

Overview

Basic Information

• Taxon OID: 3300022555
• Scaffold ID: Ga0212088_10656909
• Source Dataset Name: Alinen_combined assembly
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 634
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location

• Location Name: Finland: Lake Alinen Mustajarvi
• Coordinates
  • Lat. (^o): 61.5637
  • Long. (^o): 22.044
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040440	Metagenome	161	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0212088_106569091	F040440	N/A	KPGYGTFFYQAPEDKKHPQGPDFTGHVVLEMDYKAGERINIGLWQKQTRMGSTMFSAREDNWKKKKQLEQSQPTEVTPAYAKPKNTYNRSRDEDVPF